PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g096730.1
Common NameMTR_8g096730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WRKY
Protein Properties Length: 149aa    MW: 17283.7 Da    PI: 10.011
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g096730.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.2e-3169127159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDg++WrKYG K+vk+++fprsYY+Ct++gC+vkk+++r ++d++vve+ Yeg H h+
  Medtr8g096730.1  69 LDDGFRWRKYGEKMVKDNKFPRSYYKCTYQGCKVKKQIQRHSKDEQVVETSYEGMHIHP 127
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.0E-3155127IPR003657WRKY domain
SuperFamilySSF1182901.57E-2761128IPR003657WRKY domain
PROSITE profilePS5081128.02464129IPR003657WRKY domain
SMARTSM007743.4E-3569128IPR003657WRKY domain
PfamPF031069.8E-2570127IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MEKHEVLLPI SSSPDASPFN VKPGNGSNIH VKIAEYLKTK KKETSSQKGG KEIMKHKYVF  60
QTRSQIDILD DGFRWRKYGE KMVKDNKFPR SYYKCTYQGC KVKKQIQRHS KDEQVVETSY  120
EGMHIHPVEK SAESFDQILR NFITNNQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2660126874Probable WRKY transcription factor 4
2lex_A3e-2660126874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013446987.11e-108WRKY family transcription factor
SwissprotQ9FYA22e-42WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A072TU161e-108A0A072TU16_MEDTR; Uncharacterized protein
STRINGGLYMA08G01430.17e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-43WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]